PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0152s0067.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 274aa    MW: 30472.2 Da    PI: 7.9182
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0152s0067.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.1e-331771155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+WtpeLH+rFvea+++LGG++kAtPk++++lmk++gLtl+h+kSHLQk+Rl
  Kalax.0152s0067.1.p 17 KPRLKWTPELHSRFVEAIAKLGGPDKATPKSVMKLMKIPGLTLYHLKSHLQKFRL 71
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4491474IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-301574IPR009057Homeodomain-like
SuperFamilySSF466892.15E-161672IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-231772IPR006447Myb domain, plants
PfamPF002491.8E-81969IPR001005SANT/Myb domain
PfamPF143791.3E-20110155IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGLPDQNTSL ILSTDAKPRL KWTPELHSRF VEAIAKLGGP DKATPKSVMK LMKIPGLTLY  60
HLKSHLQKFR LGKSQLSETC PDSRPEDRGQ IHFDQDDHGA SLKQINENFK IAQALQLQME  120
VQTQLHTQIE VQRRLQLRIE AQGKYLQSVL KKAQESLAGY KNTSQCELSE LVSMVNSSCQ  180
NSSALSDLTE TESCRLRDLA KGLARCARSS DASPTSSSSP AQEQQDSLNH QLNTRKRNGS  240
TALDADDQQT AKRPRLSLQL SLDLNSEYED QSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108678.11e-83Myb family transcription factor APL
SwissprotQ9SAK53e-50APL_ARATH; Myb family transcription factor APL
TrEMBLW9SPH91e-83W9SPH9_9R
STRINGVIT_01s0026g02550.t015e-82(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-64G2-like family protein